Lt22.1 (P09880) Protein Card

General Information

Name	Lt22.1 (named by ConoServer)
Alternative name(s)	Lt101
Organism	Conus litteratus
Organism region	Indo-Pacific
Organism diet	vermivorous
Protein Type	Wild type
Protein precursor	Lt22.1 precursor (9881)

Classification

Conopeptide class	conotoxin
Gene superfamily	E superfamily
Cysteine framework	XXII
Pharmacological family

Sequence

NCQNGPNMHHTYRCRSRQRCAIIRKRNGQLTCELKCKCESV GDCLQGEVVDWDVRTVKTYTCP
Sequence evidence	nucleic acid level
Average Mass	7295.32
Monoisotopic Mass	7290.38
Isoelectric Point	11.66
Extinction Coefficient [280nm]	8480.00

References

Li,X., Chen,W., Zhangsun,D. and Luo,S. (2020) Diversity of Conopeptides and Their Precursor Genes of Conus Litteratus. Mar Drugs 18

Internal links

Protein Precursor	Lt22.1 precursor (9881)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 2 October 2023