Lt14.5 precursor (P09816) Protein Card

General Information
Name Lt14.5 precursor (named by ConoServer)
Alternative name(s) Lt120 precursor
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type

Classification
Conopeptide class conotoxin
Gene superfamily J superfamily
Pharmacological family

Sequence
MTSVQSVTCCCLLWLMLSLTLVTP
GSPGPAQLPGHRAAR
VP
AEPILEEICPDMCNSGEGEIFCTCGSRQFVVTLPVIE
RKRS
MAV
Sequence evidence nucleic acid level
Sequence region
[1-24]signal sequence
[40-78]mature peptideLt14.5
Average Mass 9134.80
Monoisotopic Mass 9128.50
Isoelectric Point 6.07
Extinction Coefficient [280nm] 6375.00

References
Li,X., Chen,W., Zhangsun,D. and Luo,S. (2020) Diversity of Conopeptides and Their Precursor Genes of Conus Litteratus. Mar Drugs 18

Internal links
Nucleic acids Lt14.5, complete cds
Structure

External links

Tools