Eu11.8 (P09799) Protein Card

General Information

Name	Eu11.8 (named by ConoServer)
Organism	Conus eburneus
Organism diet	generalist
Protein Type	Wild type

Classification

Conopeptide class	conotoxin
Gene superfamily
Cysteine framework	XI
Pharmacological family

Sequence

QFDCVDGGEQCRVNSNCCSYLCCPKSIGKRCAIQRSVGCDD FRI
Sequence evidence	nucleic acid level
Average Mass	4870.50
Monoisotopic Mass	4867.07
Isoelectric Point	9.90
Extinction Coefficient [280nm]	1490.00

References

Itang,C.E.M.M., Gaza,J.T., Masacupan,D.J.M., Batoctoy,D.C.R., Chen,Y.J., Nellas,R.B. and Yu,E.T. (2020) Identification of Conomarphin Variants in the Conus eburneus Venom and the Effect of Sequence and PTM Variations on Conomarphin Conformations. Mar Drugs 18

Internal links

Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 11 December 2023