Im14.3 (P08773) Protein Card

General Information

Name	Im14.3 (named by ConoServer)
Organism	Conus imperialis
Organism region	Indo-Pacific
Organism diet	vermivorous
Protein Type	Wild type
Protein precursor	Im14.3 precursor (8772)

Classification

Conopeptide class	conotoxin
Gene superfamily
Cysteine framework	XIV
Pharmacological family

Sequence

ADDTSGDDCVDTNEDCVNWASTGQCEANPSYMRENC
Sequence evidence	protein level
Average Mass	3912.99
Monoisotopic Mass	3910.41
Isoelectric Point	3.96
Extinction Coefficient [280nm]	6990.00

References

Jin, A.H., Dutertre, S., Dutt, M., Lavergne, V., Jones, A., Lewis, R.J. and Alewood, P.F. (2019) Transcriptomic-Proteomic Correlation in the Predation-Evoked Venom of the Cone Snail, Conus imperialis Marine drugs 17:177

Internal links

Protein Precursor	Im14.3 precursor (8772)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Friday 29 September 2023