C8.4 (P08523) Protein Card

General Information

Name	C8.4 (named by ConoServer)
Alternative name(s)	Ca083
Organism	Conus catus
Organism region	Indo-Pacific
Organism diet	piscivorous
Protein Type	Wild type

Classification

Conopeptide class	conotoxin
Gene superfamily	S superfamily
Cysteine framework	VIII
Pharmacological family

Sequence

ZYPLGCOGTCGKGGKCVGTCECTNYTNCYCSSKGFREPGCS CTCPT
Modified residues	position symbol name 1 Z Pyroglutamic acid 7 O 4-Hydroxyproline
Sequence evidence	protein level
Average Mass	4755.29
Monoisotopic Mass	4751.78
Isoelectric Point	NA
Extinction Coefficient [280nm]	NA

References

Himaya, S.W.A., Jin, A.H., Dutertre, S., Giacomotto, J., Mohialdeen, H., Vetter, I., Alewood, P.F. and Lewis, R.J. (2015) Comparative venomics reveals the complex prey capture strategy of the piscivorous cone snail Conus catus. Journal of proteome research 14:4372-4381

Internal links

Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Sunday 24 September 2023