X11.1 (P08498) Protein Card

General Information

Name	X11.1 (named by ConoServer)
Alternative name(s)	I1_xm11a
Organism	Conus ximenes
Organism region	Eastern Pacific
Protein Type	Wild type
Notes	X11.1 was tested at 100 μg/mL (24 μM) on the H37Rv strain， its activity is at a micromolar concentration. The MIC of X11.1 is 3 μM,which is potent to be used in anti-TB therapy.

Classification

Conopeptide class	conotoxin
Gene superfamily
Cysteine framework	XI
Pharmacological family

Sequence

GRCRGFREDCSQHRDCCGDLCCNGNTCVITVIACPKW
Sequence evidence	protein level
Average Mass	4112.66
Monoisotopic Mass	4109.69
Isoelectric Point	10.40
Extinction Coefficient [280nm]	5500.00

References

Figueroa-Montiel, A., Bernáldez, J., Jiménez, S., Ueberhide, B., González, L. and Licea-Navarro, A. (2018) Antimycobacterial activity: A new pharmacological target for conotoxins found in the first reported conotoxin from Conasprella ximenes Toxins 10:51

Internal links

Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 11 December 2023