E22.1 (P08485) Protein Card

General Information

Name	E22.1 (named by ConoServer)
Organism	Conus ermineus (Atlantic fish-hunting cone)
Organism region	Eastern Atlantic and Mediterranean,Western Atlantic and Caribbean
Organism diet	piscivorous
Protein Type	Wild type
Protein precursor	E22.1 precursor (8484)

Classification

Conopeptide class	conotoxin
Gene superfamily	E superfamily
Cysteine framework	XXII
Pharmacological family

Sequence

WPRLTDSDCELGRNMHITCKQLDQCGVIEKKDGQLTCKLRC KCKPGKRCLRKENIDWSDITTRIYHCPWP
Sequence evidence	nucleic acid level
Average Mass	8255.59
Monoisotopic Mass	8249.99
Isoelectric Point	11.06
Extinction Coefficient [280nm]	17990.00

References

Abalde, S., Tenorio, M.J., Afonso, C.M. and Zardoya, R. (2018) Conotoxin diversity in Chelyconus ermineus (Born, 1778) and the convergent origin of piscivory in the Atlantic and Indo-Pacific cones Genome biology and evolution 10:2643-2662

Internal links

Protein Precursor	E22.1 precursor (8484)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 2 October 2023