Cal6.41b (P08342) Protein Card

General Information
Name Cal6.41b (named by ConoServer)
Alternative name(s) O3_cal6.1b
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Cal6.41b precursor (7879)

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
SLDTREICWNHSECDDPSEWCCRMGSGHGSCQPVCRP
Sequence evidence nucleic acid level
Average Mass 4176.55
Monoisotopic Mass 4173.62
Isoelectric Point 5.17
Extinction Coefficient [280nm] 11000.00

References
Bernáldez-Sarabia, J., Figueroa-Montiel, A., Dueñas, S., Cervantes-Luévano, K., Beltrán, J.A., Ortiz, E., Jiménez, S., Possani, L.D., Paniagua-Solís, J.F., Gonzalez-Canudas, J. and Licea-Navarro, A. (2019) The Diversified O-Superfamily in Californiconus californicus Presents a Conotoxin with Antimycobacterial Activity Toxins 11:128

Internal links
Protein Precursor Cal6.41b precursor (7879)
Nucleic acids
Structure

External links

Tools