Cal27 (P08340) Protein Card

General Information
Name Cal27 (named by ConoServer)
Alternative name(s) O3_cal27
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Cal27 precursor (7884)

Classification
Conopeptide class conotoxin
Gene superfamily
Pharmacological family

Sequence
MLSSLIQAHERDSEESCKSYGGGPCPSGEDCCCPPGRSTGT
CKRTCNNGSVCA
Sequence evidence nucleic acid level
Average Mass 5462.98
Monoisotopic Mass 5459.20
Isoelectric Point 6.64
Extinction Coefficient [280nm] 1490.00

References

Internal links
Protein Precursor Cal27 precursor (7884)
Nucleic acids
Structure

External links

Tools