Cal30 (P08338) Protein Card

General Information
Name Cal30 (named by ConoServer)
Alternative name(s) O2_cal30
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Cal30 precursor (7876)

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework XXX
Pharmacological family

Sequence
KAARGWLFNEVETCELGGLGDPCSGSGDCCCDQCLCSGSYE
HCTQNPDRWFCCRTYGN
Sequence evidence nucleic acid level
Average Mass 6337.91
Monoisotopic Mass 6333.45
Isoelectric Point 5.27
Extinction Coefficient [280nm] 13980.00

References
Bernáldez-Sarabia, J., Figueroa-Montiel, A., Dueñas, S., Cervantes-Luévano, K., Beltrán, J.A., Ortiz, E., Jiménez, S., Possani, L.D., Paniagua-Solís, J.F., Gonzalez-Canudas, J. and Licea-Navarro, A. (2019) The Diversified O-Superfamily in Californiconus californicus Presents a Conotoxin with Antimycobacterial Activity Toxins 11:128

Internal links
Protein Precursor Cal30 precursor (7876)
Nucleic acids
Structure

External links

Tools