Cal6.37 (P08336) Protein Card

General Information
Name Cal6.37 (named by ConoServer)
Alternative name(s) O1_cal6.37
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Cal6.37 precursor (7871)

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
QLKKLRRECYLEPGDSCFHHDGRGACCEGTCFFGVACVPW
Sequence evidence nucleic acid level
Average Mass 4514.14
Monoisotopic Mass 4510.97
Isoelectric Point 8.15
Extinction Coefficient [280nm] 6990.00

References
Bernáldez-Sarabia, J., Figueroa-Montiel, A., Dueñas, S., Cervantes-Luévano, K., Beltrán, J.A., Ortiz, E., Jiménez, S., Possani, L.D., Paniagua-Solís, J.F., Gonzalez-Canudas, J. and Licea-Navarro, A. (2019) The Diversified O-Superfamily in Californiconus californicus Presents a Conotoxin with Antimycobacterial Activity Toxins 11:128

Internal links
Protein Precursor Cal6.37 precursor (7871)
Nucleic acids
Structure

External links

Tools