Cal6.20 (P08319) Protein Card

General Information
Name Cal6.20 (named by ConoServer)
Alternative name(s) O1_cal6.20
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Cal6.20 precursor (7854)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
GWFGEESSCWWCTGQNKCCEEAQVCQSVNYACPPARR
Sequence evidence nucleic acid level
Average Mass 4208.62
Monoisotopic Mass 4205.68
Isoelectric Point 5.80
Extinction Coefficient [280nm] 17990.00

References
Bernáldez-Sarabia,J., Figueroa-Montiel,A., Dueñas,S., Cervantes-Luévano,K., Beltrán,J.A., Ortiz,E., Jiménez,S., Possani,L.D., Paniagua-Solís,J.F., Gonzalez-Canudas,J., and Licea-Navarro,A. (2019) The Diversified O-Superfamily in Californiconus californicus Presents a Conotoxin with Antimycobacterial Activity Toxins 11:128

Internal links
Protein Precursor Cal6.20 precursor (7854)
Nucleic acids
Structure

External links

Tools