R11.1 (P00828) Protein Card

General Information

Name	R11.1
Organism	Conus radiatus
Organism region	Indo-Pacific
Organism diet	piscivorous
Protein Type	Wild type

Classification

Conopeptide class	conotoxin
Gene superfamily	I1 superfamily
Cysteine framework	XI
Pharmacological family

Sequence

GHVPCGKDGRKCGYHADCCNCCLSGICKPSTSWTGCSTSTF D
Sequence evidence	nucleic acid level
Average Mass	4378.86
Monoisotopic Mass	4375.72
Isoelectric Point	9.71
Extinction Coefficient [280nm]	6990.00

References

Jimenez,E.C., Shetty,R.P., Lirazan,M., Rivier,J., Walker,C., Abogadie,F.C., Yoshikami,D., Cruz,L.J. and Olivera,B.M. (2003) Novel excitatory Conus peptides define a new conotoxin superfamily J. Neurochem. 85:610-621

Internal links

Nucleic acids	Conus radiatus I-superfamily conotoxin R11.1 (R11.1) mRNA, partial cds
Structure

External links

UniProtKB/Swiss-Prot	Q7Z0A6
Ncbi	Q7Z0A6, AAP41529

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Tuesday 26 September 2023