Qc11.1 (P08266) Protein Card

General Information

Name	Qc11.1 (named by ConoServer)
Alternative name(s)	Qu-10
Organism	Conus quercinus
Organism region	Indo-Pacific
Organism diet	vermivorous
Protein Type	Wild type
Protein precursor	Qc11.1 precursor (7818)

Classification

Conopeptide class	conotoxin
Gene superfamily	I2 superfamily
Cysteine framework	XI
Pharmacological family

Sequence

CYPEGDYCEYHYQCCKGSCCFAYCRDPCRRV
Sequence evidence	nucleic acid level
Average Mass	3714.15
Monoisotopic Mass	3711.34
Isoelectric Point	8.97
Extinction Coefficient [280nm]	7450.00

References

Yao, G., Peng, C., Zhu, Y., Fan, C., Jiang, H., Chen, J., Cao, Y. and Shi, Q. (2019) High-Throughput Identification and Analysis of Novel Conotoxins from Three Vermivorous Cone Snails by Transcriptome Sequencing Marine drugs 17:193

Gao,B., Peng,C., Zhu,Y., Sun,Y., Zhao,T., Huang,Y. and Shi,Q. (2018) High Throughput Identification of Novel Conotoxins from the Vermivorous Oak Cone Snail (Conus quercinus) by Transcriptome Sequencing Int J Mol Sci 19:3901

Internal links

Protein Precursor	Qc11.1 precursor (7818)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 11 December 2023