Conkunitzin-Ca3 (P08200) Protein Card

General Information
Name Conkunitzin-Ca3 (named by ConoServer)
Alternative name(s) Ca-100
Organism Conus caracteristicus (characteristic cone)
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Ca9.4 precursor (7743)

Classification
Conopeptide class conkunitzin
Gene superfamily
Pharmacological family

Sequence
CQQPKAPGRCMAYMERYFFNSEKGACEQFIYGGCEGNENNF
ETLEACQTAC
Sequence evidence nucleic acid level
Average Mass 5763.37
Monoisotopic Mass 5759.36
Isoelectric Point 5.66
Extinction Coefficient [280nm] 4470.00

References
Yao, G., Peng, C., Zhu, Y., Fan, C., Jiang, H., Chen, J., Cao, Y. and Shi, Q. (2019) High-Throughput Identification and Analysis of Novel Conotoxins from Three Vermivorous Cone Snails by Transcriptome Sequencing Marine drugs 17:193

Internal links
Protein Precursor Ca9.4 precursor (7743)
Nucleic acids
Structure

External links

Tools