Cal12.1.3b (P00814) Protein Card

General Information
Name Cal12.1.3b
Alternative name(s) CalTx 12.1.4D
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework XII
Pharmacological family

Sequence
DVCDSLVDGRCIHNGCFCEESKPNGNCCDSGGCVWWWCPGT
KWD
Sequence evidence Unknown
Average Mass 4875.34
Monoisotopic Mass 4871.86
Isoelectric Point 4.62
Extinction Coefficient [280nm] 22000.00

References
Gilly, W.F., Richmond, T.A., Duda, T.F., Elliger, C., Lebaric, Z., Schulz, J., Bingham, J.P. and Sweedler, J.V., (2011) Gilly, W.F., Richmond, T.A., Duda, T.F., Elliger, C., Lebaric, Z., Schulz, J., Bingham, J.P. and Sweedler, J.V., 2011. A diverse family of novel peptide toxins from an unusual cone snail, Conus californicus Journal of Experimental Biology 214:147-161

Internal links
Nucleic acids Cal12.1.3b mRNA, partial cds
Structure

External links
UniProtKB/Swiss-Prot A6YR41
Ncbi A6YR41, ABR92965

Tools