CalTx 12.1.4B (P00812) Protein Card

General Information
Name CalTx 12.1.4B
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type
Notes This sequence has been removed from GenBank at the submitter's request because the sequence cannot be confirmed.

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework XII
Pharmacological family

Sequence
DVCDSLVDGRCIHNGCFCEESKPNGNCCDTGGCTAAWWCPG
TKWD
Sequence evidence Unknown
Average Mass 4847.28
Monoisotopic Mass 4843.85
Isoelectric Point 4.62
Extinction Coefficient [280nm] 16500.00

References
Gilly, W.F., Richmond, T.A., Duda, T.F., Elliger, C., Lebaric, Z., Schulz, J., Bingham, J.P. and Sweedler, J.V., (2011) Gilly, W.F., Richmond, T.A., Duda, T.F., Elliger, C., Lebaric, Z., Schulz, J., Bingham, J.P. and Sweedler, J.V., 2011. A diverse family of novel peptide toxins from an unusual cone snail, Conus californicus Journal of Experimental Biology 214:147-161

Internal links
Nucleic acids CalTx 12.1.4B precursor
Structure

External links
Ncbi ABR92963

Tools