T9.1 (P08096) Protein Card

General Information
Name T9.1 (named by ConoServer)
Alternative name(s) Tu078
Organism Conus tulipa (tulip cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor T9.1 precursor (8007)

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework IX
Pharmacological family

Sequence
QFFCPSSEDESLNCIETMGTTATCMKSNRGETYSYACGYCG
KKKETCFGAKSQ
Sequence evidence nucleic acid level
Average Mass 5817.45
Monoisotopic Mass 5813.43
Isoelectric Point 7.98
Extinction Coefficient [280nm] 4470.00

References
Dutt, M., Dutertre, S., Jin, A.H., Lavergne, V., Alewood, P.F. and Lewis, R.J. (2019) Venomics reveals venom complexity of the piscivorous cone snail, Conus tulipa Marine drugs 17:71

Internal links
Protein Precursor T9.1 precursor (8007)
Nucleic acids
Structure

External links

Tools