Conkunitzin-T2 (P08093) Protein Card

General Information
Name Conkunitzin-T2 (named by ConoServer)
Organism Conus tulipa (tulip cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Conkunitzin-T2 precursor (8004)

Classification
Conopeptide class conkunitzin
Gene superfamily
Cysteine framework IX
Pharmacological family

Sequence
ATLRNPSLCSLLPDTGSCRAAFHMFYFDQFSKECKVFIYGG
CDGNANRFLNSKACYKTCGN
Sequence evidence nucleic acid level
Average Mass 6777.69
Monoisotopic Mass 6773.07
Isoelectric Point 11.08
Extinction Coefficient [280nm] 4470.00

References
Dutt, M., Dutertre, S., Jin, A.H., Lavergne, V., Alewood, P.F. and Lewis, R.J. (2019) Venomics reveals venom complexity of the piscivorous cone snail, Conus tulipa Marine drugs 17:71

Internal links
Protein Precursor Conkunitzin-T2 precursor (8004)
Nucleic acids
Structure

External links

Tools