Vx10 (P08056) Protein Card

General Information
Name Vx10
Organism Conus vexillum
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type

Classification
Conopeptide class conantokin
Gene superfamily B2 superfamily
Pharmacological family

Sequence
FPQRRDGAPADNLKSFDPAGSAGNGWWHAQHAGNAAHGQHG
PRPNAAFQP
Sequence evidence nucleic acid level
Average Mass 5271.66
Monoisotopic Mass 5268.48
Isoelectric Point 10.06
Extinction Coefficient [280nm] 11000.00

References
Prashanth,J.R., Dutertre,S., Jin,A.H., Lavergne,V., Hamilton,B., Cardoso,F.C., Griffin,J., Venter,D.J., Alewood,P.F. and Lewis,R.J. (2016) The role of defensive ecological interactions in the evolution of conotoxins. Mol. Ecol. 25:598-615

Internal links
Nucleic acids
Structure

External links

Tools