Conkunitzin-T2 precursor (P08004) Protein Card

General Information
Name Conkunitzin-T2 precursor (named by ConoServer)
Alternative name(s) Tu075 precursor
Organism Conus tulipa (tulip cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor
Notes Conkunitzin

Classification
Conopeptide class conkunitzin
Gene superfamily
Cysteine framework IX
Pharmacological family

Sequence
MEGRRVAAVLIVTICMLELEA
ATLRNPSLCSLLPDTGSCRA
AFHMFYFDQFSKECKVFIYGGCDGNANRFLNSKACYKTCGN
K
Sequence evidence nucleic acid level
Sequence region
[1-21]signal sequence
[22-82]mature peptideConkunitzin-T2

References
Dutt, M., Dutertre, S., Jin, A.H., Lavergne, V., Alewood, P.F. and Lewis, R.J. (2019) Venomics reveals venom complexity of the piscivorous cone snail, Conus tulipa Marine drugs 17:71

Internal links
Nucleic acids
Structure

External links

Tools