Cal30 precursor (P07876) Protein Card

General Information
Name Cal30 precursor (named by ConoServer)
Alternative name(s) O2_cal30 precursor
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework XXX
Pharmacological family

Sequence
MEKLIILLLVASLLVTTDSVVKGK
KAARGWLFNEVETCELG
GLGDPCSGSGDCCCDQCLCSGSYEHCTQNPDRWFCCRTYGN
Sequence region
[1-24]signal sequence
[25-82]mature peptideCal30

References
Bernáldez-Sarabia, J., Figueroa-Montiel, A., Dueñas, S., Cervantes-Luévano, K., Beltrán, J.A., Ortiz, E., Jiménez, S., Possani, L.D., Paniagua-Solís, J.F., Gonzalez-Canudas, J. and Licea-Navarro, A. (2019) The Diversified O-Superfamily in Californiconus californicus Presents a Conotoxin with Antimycobacterial Activity Toxins 11:128

Internal links
Nucleic acids
Structure

External links

Tools