Ca9.3 precursor (P07742) Protein Card

General Information
Name Ca9.3 precursor (named by ConoServer)
Alternative name(s) Ca-99 precursor
Organism Conus caracteristicus (characteristic cone)
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework IX
Pharmacological family

Sequence
VLILTICMLAVAAGASRR
WGLCSLPAEAGPCYASITRYYYD
RKTQECTQFYYGGCGGNSNNFDTAEECDDVC
Sequence evidence nucleic acid level
Sequence region
[1-18]pro region
[19-72]mature peptideConkunitzin-Ca6

References
Yao, G., Peng, C., Zhu, Y., Fan, C., Jiang, H., Chen, J., Cao, Y. and Shi, Q. (2019) High-Throughput Identification and Analysis of Novel Conotoxins from Three Vermivorous Cone Snails by Transcriptome Sequencing Marine drugs 17:193

Internal links
Nucleic acids
Structure

External links

Tools