TxMEKL-0511/TxMEKL-0512 precursor (P00712) Protein Card

General Information
Name TxMEKL-0511/TxMEKL-0512 precursor
Organism Conus textile (Cloth-of-gold cone)
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily O2 superfamily
Pharmacological family

Sequence
MEKLTILLLVAAVLLSIQA
LNQEKHQRAKINLLSKRKPPAE
R
WWRWGGCMAWFGLCSKDSECCSNSCDVTRCELMPFPPDW
Sequence region
[1-19]signal sequence
[43-81]mature peptideTxMEKL-0511/TxMEKL-0512

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Nucleic acids Conus textile clone TxMEKL-0511 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Conus textile clone TxMEKL-0512 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Structure

External links
UniProtKB/Swiss-Prot Q9BHA0
Ncbi AAG60453, AAG60526, Q9BHA0

Tools