Sa6.1 (P06837) Protein Card

General Information
Name Sa6.1
Organism Conus sanguinolentus
Organism region Indo-Pacific
Protein Type Wild type
Protein precursor Sa6.1 precursor (6836)
Notes Sequence homology to SuVIA - may possibly have an essential role in prey capture or defence (Jin et al., 2015)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
DEMKNPKAFELTECSSYGEFCFPGIKDCCMGYCFIMCLPTS
PHD
Sequence evidence nucleic acid level
Average Mass 4983.70
Monoisotopic Mass 4980.02
Isoelectric Point 5.21
Extinction Coefficient [280nm] 2980.00

References
Jin,A.H., Israel,M.R., Inserra,M.C., Smith,J.J., Lewis,R.J., Alewood,P.F., Vetter,I. and Dutertre,S. (2015) δ-Conotoxin SuVIA suggests an evolutionary link between ancestral predator defence and the origin of fish-hunting behaviour in carnivorous cone snails. Proc. Biol. Sci. 282

Internal links
Protein Precursor Sa6.1 precursor (6836)
Nucleic acids
Structure

External links

Tools