Vc22.1 (P06659) Protein Card

General Information

Name	Vc22.1
Organism	Conus victoriae
Organism region	Indo-Pacific
Organism diet	molluscivorous
Protein Type	Wild type
Protein precursor	Vc22.1 precursor (6393)
Notes	Predicted by ConoServer from protein precursor

Classification

Conopeptide class	conotoxin
Gene superfamily	A superfamily
Cysteine framework	XXII
Pharmacological family

Sequence

DCPVTGGPNPFHHCKIACMSTGTEEYCNCVYCKDCVNSNGE KPAC
Sequence evidence	nucleic acid level
Average Mass	4819.37
Monoisotopic Mass	4815.88
Isoelectric Point	6.62
Extinction Coefficient [280nm]	2980.00

References

Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9

Internal links

Protein Precursor	Vc22.1 precursor (6393)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 2 October 2023