E_Vc1 (P06658) Protein Card

General Information

Name	E_Vc1
Organism	Conus victoriae
Organism region	Indo-Pacific
Organism diet	molluscivorous
Protein Type	Wild type
Protein precursor	E_Vc1 precursor (6387)
Notes	Predicted by ConoServer from protein precursor

Classification

Conopeptide class	conotoxin
Gene superfamily
Cysteine framework	XXII
Pharmacological family

Sequence

WPRLYDGDCTRGPNMHITCFKDQSCGLIVKRNGRLSCTLNC KCRRNESCLPSEEVDWDNRNMKIVICPKPWF
Sequence evidence	nucleic acid level
Average Mass	8441.73
Monoisotopic Mass	8435.94
Isoelectric Point	11.17
Extinction Coefficient [280nm]	17990.00

References

Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9

Internal links

Protein Precursor	E_Vc1 precursor (6387)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Tuesday 28 November 2023