Vc12.1 (P06644) Protein Card

General Information

Name	Vc12.1
Organism	Conus victoriae
Organism region	Indo-Pacific
Organism diet	molluscivorous
Protein Type	Wild type
Protein precursor	Vc12.1 precursor (6372)
Notes	Predicted by ConoServer from protein precursor

Classification

Conopeptide class	conotoxin
Gene superfamily	I2 superfamily
Cysteine framework	XII
Pharmacological family

Sequence

SCDSEFSSEFCERPEESCSCLTHSCCHWSRRDQCMTPQRCI SAQKGN
Sequence evidence	nucleic acid level
Average Mass	5382.86
Monoisotopic Mass	5379.10
Isoelectric Point	5.93
Extinction Coefficient [280nm]	5500.00

References

Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9

Internal links

Protein Precursor	Vc12.1 precursor (6372)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Thursday 28 September 2023