Vc14.3 (P06641) Protein Card

General Information
Name Vc14.3
Organism Conus victoriae
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Vc14.3 precursor (6369)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily J superfamily
Cysteine framework XIV
Pharmacological family

Sequence
AFQDIFMVALCPVFCFSNVALESCNCEEILDLVSSLIS
Sequence evidence nucleic acid level
Average Mass 4167.84
Monoisotopic Mass 4164.93
Isoelectric Point 2.93
Extinction Coefficient [280nm] -1.00

References
Robinson,S.D., Safavi-Hemami,H., McIntosh,L.D., Purcell,A.W., Norton,R.S. and Papenfuss,A.T. (2014) Diversity of Conotoxin Gene Superfamilies in the Venomous Snail, Conus victoriae. PLoS ONE 9

Internal links
Protein Precursor Vc14.3 precursor (6369)
Nucleic acids
Structure

External links

Tools