Mr108 (P06552) Protein Card

General Information
Name Mr108
Organism Conus marmoreus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Mr108 precursor (6246)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
ACRKKWEYCIVPILGFVYCCPGLICGPFVCV
Sequence evidence nucleic acid level
Average Mass 3475.28
Monoisotopic Mass 3472.65
Isoelectric Point 11.12
Extinction Coefficient [280nm] 8480.00

References
Lavergne,V., Dutertre,S., Jin,A.H., Lewis,R.J., Taft,R.J. and Alewood,P.F. (2013) Systematic interrogation of the Conus marmoreus venom duct transcriptome with ConoSorter reveals 158 novel conotoxins and 13 new gene superfamilies BMC Genomics 14:708

Internal links
Protein Precursor Mr108 precursor (6246)
Nucleic acids
Structure

External links

Tools