Mr11.2 (P05369) Protein Card

General Information

Name	Mr11.2
Alternative name(s)	Mr004
Organism	Conus marmoreus
Organism region	Indo-Pacific
Organism diet	molluscivorous
Protein Type	Wild type
Protein precursor	Mr11.2 precursor (5368)

Classification

Conopeptide class	conotoxin
Gene superfamily	I1 superfamily
Cysteine framework	XI
Pharmacological family

Sequence

DKWGTCSLLGKGCRHHSDCCWDLCCTGKTCVMTVLPCHFFP L
Sequence evidence	protein level
Average Mass	4695.50
Monoisotopic Mass	4692.00
Isoelectric Point	10.24
Extinction Coefficient [280nm]	11000.00

References

Dutertre,S., Jin,A.H., Kaas,Q., Jones,A., Alewood,P.F. and Lewis,R.J. (2013) Deep venomics reveals the mechanism for expanded peptide diversity in cone snail venom. Mol. Cell Proteomics 12:312-329

Internal links

Protein Precursor	Mr11.2 precursor (5368)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 11 December 2023