Im23a (P05215) Protein Card

General Information
Name Im23a
Organism Conus imperialis
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Im23a precursor (5221)

Classification
Conopeptide class conotoxin
Gene superfamily K superfamily
Cysteine framework XXIII
Pharmacological family

Sequence
IPYCGQTGAECYSWCIKQDLSKDWCCDFVKDIRMNPPADKC
P
Sequence evidence protein level
Average Mass 4823.51
Monoisotopic Mass 4820.07
Isoelectric Point 6.45
Extinction Coefficient [280nm] 13980.00

References
Ye,M., Khoo,K.K., Xu,S., Zhou,M., Boonyalai,N., Perugini,M.A., Chi,C., Galea,C.A., Wang,C. and Norton,R.S. (2012) A Helical Conotoxin From Conus Imperialis Has A Novel Cysteine Framework And Defiines A New Superfamily J Biol Chem 287:14973-14983
Jin, A.H., Dutertre, S., Dutt, M., Lavergne, V., Jones, A., Lewis, R.J. and Alewood, P.F. (2019) Transcriptomic-Proteomic Correlation in the Predation-Evoked Venom of the Cone Snail, Conus imperialis Marine drugs 17:177

Internal links
Protein Precursor Im23a precursor (5221)
Nucleic acids
Structure Solution NMR structure of the novel conotoxin im23a from Conus imperialis

External links
Ncbi 2LMZ_A

Tools