Tx3-TP08 precursor (P04897) Protein Card

General Information
Name Tx3-TP08 precursor
Organism Conus textile (Cloth-of-gold cone)
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily M superfamily
Pharmacological family

Sequence
M
MFKLGVLLTICLLLFSLNA
VPLDGDQPADQPAER
LPDDIS
SENNPFYDPVKWCCMTCFGCTPCCGSPASSSV
Sequence region
[2-20]signal sequence
[36-73]mature peptideTx3-TP08

References

Internal links
Nucleic acids Conus textile M superfamily MMSK group conopeptide Tx3-TP08 mRNA, complete cds.
Structure

External links
Ncbi AEX60408

Tools