Cal12.1p5 (P04679) Protein Card

General Information
Name Cal12.1p5
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Cal12.1p5 precursor (4628)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily
Cysteine framework XII
Pharmacological family

Sequence
DVCDSLVEGRCIHNGCYCDRSAPHGNCCHTDGCTVAFWCPG
TKWD
Sequence evidence nucleic acid level
Average Mass 4925.40
Monoisotopic Mass 4921.91
Isoelectric Point 6.26
Extinction Coefficient [280nm] 12490.00

References

Internal links
Protein Precursor Cal12.1p5 precursor (4628)
Nucleic acids
Structure

External links

Tools