Eu14.1 (P04642) Protein Card

General Information
Name Eu14.1
Alternative name(s) Eb14.1
Organism Conus eburneus
Organism diet generalist
Protein Type Wild type
Protein precursor Eu14.1 precursor (4534)
Notes This peptide, extracted from Conus eburneus, was originally published under the name "Eb14.1" but the abbreviation "Eb" was already in used for peptides extracted from Conus ebraeus. Therefore the peptide was rename "Eu14.1".

Classification
Conopeptide class conotoxin
Gene superfamily J superfamily
Cysteine framework XIV
Pharmacological family

Sequence
VPAEPILEEICPDMCNSGEGEIFCTCGSRQFVVTLPVIE
Sequence evidence nucleic acid level
Average Mass 4222.84
Monoisotopic Mass 4219.93
Isoelectric Point 3.73
Extinction Coefficient [280nm] -1.00

References
Liu,Z., Li,H., Liu,N., Wu,C., Jiang,J., Yue,J. and Dai,Q. (2012) Diversity and evolution of conotoxins in Conus virgo, Conus eburneus, Conus imperialis and Conus marmoreus from the South China Sea. Toxicon 60:982-989

Internal links
Protein Precursor Eu14.1 precursor (4534)
Nucleic acids
Structure

External links

Tools