Lt14.5 (P04634) Protein Card

General Information
Name Lt14.5
Alternative name(s) Lt120,Lt14.2
Organism Conus litteratus
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Lt14.5 precursor (4537)
Lt14.5 precursor (9816)
Notes Predicted by ConoServer from protein precursor. The NCBI cards from the precursor called this peptide Lt14.2 but the name was already in use for a different peptide. It was therefore renamed Lt14.5.

Classification
Conopeptide class conotoxin
Gene superfamily J superfamily
Cysteine framework XIV
Pharmacological family

Sequence
VPAEPILEEICPDMCNSGEGEIFCTCGSRQFVVTLPVIE
Sequence evidence nucleic acid level
Average Mass 4222.84
Monoisotopic Mass 4219.93
Isoelectric Point 3.73
Extinction Coefficient [280nm] -1.00

References
Li,X., Chen,W., Zhangsun,D. and Luo,S. (2020) Diversity of Conopeptides and Their Precursor Genes of Conus Litteratus. Mar Drugs 18

Internal links
Protein Precursor Lt14.5 precursor (4537)
Lt14.5 precursor (9816)
Nucleic acids
Structure

External links

Tools