Bu15 (P04595) Protein Card

General Information

Name	Bu15
Organism	Conus bullatus
Organism region	Indo-Pacific
Organism diet	piscivorous
Protein Type	Wild type
Protein precursor	Bu15 precursor (4594)

Classification

Conopeptide class	conotoxin
Gene superfamily	M superfamily
Cysteine framework	III
Pharmacological family

Sequence

MIFLFGGCCRMSSCQPPPVCNCCAKQDLNPDER
Sequence evidence	nucleic acid level
Average Mass	3658.25
Monoisotopic Mass	3655.51
Isoelectric Point	7.00
Extinction Coefficient [280nm]	750.00

References

Hu,H., Bandyopadhyay,P.K. and Yandell,M. (2011) Characterization of the Conus bullatus genome and its venom-duct transcriptome. BMC Genomics 12:60

Internal links

Protein Precursor	Bu15 precursor (4594)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Saturday 23 September 2023