Cal12.10 (P04151) Protein Card

General Information

Name	Cal12.10
Organism	Conus californicus
Organism region	Eastern Pacific
Organism diet	piscivorous
Protein Type	Wild type
Protein precursor	Cal12.10 precursor (4006)
Notes	Predicted by ConoServer from protein precursor

Classification

Conopeptide class	conotoxin
Gene superfamily	Divergent MSTLGMTLL-
Cysteine framework	XXII
Pharmacological family

Sequence

SDPQACEPTISGGEMICRDEVCASTGCNCGYNIAKAHCYCA CP
Sequence evidence	nucleic acid level
Average Mass	4464.96
Monoisotopic Mass	4461.71
Isoelectric Point	5.62
Extinction Coefficient [280nm]	2980.00

References

Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links

Protein Precursor	Cal12.10 precursor (4006)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 2 October 2023