Cal22f (P04148) Protein Card

General Information

Name	Cal22f
Organism	Conus californicus
Organism region	Eastern Pacific
Organism diet	piscivorous
Protein Type	Wild type
Protein precursor	Cal22f precursor (4054) Cal22f precursor (4002)

Classification

Conopeptide class	conotoxin
Gene superfamily
Cysteine framework	XXII
Pharmacological family

Sequence

YDAPYCSEEELQACDCSHNPVRDACLCQYDPAGSPACECFC VEPW
Sequence evidence	nucleic acid level
Average Mass	5011.44
Monoisotopic Mass	5007.87
Isoelectric Point	4.59
Extinction Coefficient [280nm]	9970.00

References

Elliger,C.A., Richmond,T.A., Lebaric,Z.N., Pierce,N.T., Sweedler,J.V. and Gilly,W.F. (2011) Diversity of conotoxin types from Conus californicus reflects a diversity of prey types and a novel evolutionary history. Toxicon 57:311-322

Internal links

Protein Precursor	Cal22f precursor (4054) Cal22f precursor (4002)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 2 October 2023