Cal6.3a (P04122) Protein Card

General Information
Name Cal6.3a
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Wild type
Protein precursor Cal6.3a precursor (3967)
Notes Predicted by ConoServer from protein precursor

Classification
Conopeptide class conotoxin
Gene superfamily Divergent MRFLHFLIVA
Cysteine framework VI/VII
Pharmacological family

Sequence
GWDTPAPCRYCQWNGPQCCVYYCSSCNYEEAREEGHYVSSH
LLERQ
Sequence evidence nucleic acid level
Average Mass 5413.87
Monoisotopic Mass 5410.19
Isoelectric Point 5.17
Extinction Coefficient [280nm] 18450.00

References

Internal links
Protein Precursor Cal6.3a precursor (3967)
Nucleic acids
Structure

External links

Tools