Cal8.1 precursor (P04055) Protein Card

General Information
Name Cal8.1 precursor (named by ConoServer)
Alternative name(s) CalMKLL-1 precursor
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily Divergent MKLLLTLLLG
Cysteine framework VIII
Pharmacological family

Sequence
MKLLLTLLLGSALMCITLA
DECGLGTHRPVKEVIDNVRTMY
YCDCRAGDAERSITVSRCDDNNQKQDDVILTYCGLEQTTGC
NTNPYTAAKHDSSGDKPQFYCSCLNYKYEQSHSDYRHWTIR
CYMGNICD
Sequence region
[1-19]signal sequence
[20-131]mature peptideCal8.1

References
Elliger,C.A., Richmond,T.A., Lebaric,Z.N., Pierce,N.T., Sweedler,J.V. and Gilly,W.F. (2011) Diversity of conotoxin types from Conus californicus reflects a diversity of prey types and a novel evolutionary history. Toxicon 57:311-322

Internal links
Nucleic acids CalMKLL-1 precursor
Structure

External links
UniProtKB/Swiss-Prot D3JYA5
Ncbi ADC35041, D3JYA5

Tools