Cal6.12 precursor (P04028) Protein Card

General Information
Name Cal6.12 precursor
Organism Conus californicus
Organism region Eastern Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class conotoxin
Gene superfamily Divergent M---L-LTVA
Pharmacological family

Sequence
MKFYLLLTAALLLTAVIIEA
APTDHQDEARDLMREER
DDKS
NCPISHPNYCSFTPVCCKHECLSNNKCSSSEFIPGQ
Sequence region
[1-20]signal sequence
[38-77]mature peptideCal6.12

References
Biggs,J.S., Watkins,M., Puillandre,N., Ownby,J.P., Lopez-Vera,E., Christensen,S., Moreno,K.J., Bernaldez,J., Licea-Navarro,A. and Olivera,B.M. (2010) Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol. Phylogenet. Evol. 56:1-12

Internal links
Nucleic acids Cal6.12 precursor
Structure

External links
UniProtKB/Swiss-Prot D6C4K2
Ncbi ADB93114, D6C4K2

Tools