Sr11B (P03897) Protein Card

General Information

Name	Sr11B
Alternative name(s)	Sr11.4
Organism	Conus spurius
Organism region	Western Atlantic and Caribbean
Organism diet	vermivorous
Protein Type	Wild type
Protein precursor	Sr11B precursor (3896)

Classification

Conopeptide class	conotoxin
Gene superfamily	I2 superfamily
Cysteine framework	XI
Pharmacological family

Sequence

CDSDGTSCTSNMECCGYGCCSGTCQTPCRFGP
Sequence evidence	nucleic acid level
Average Mass	3266.52
Monoisotopic Mass	3264.02
Isoelectric Point	4.20
Extinction Coefficient [280nm]	1490.00

References

Zamora-Bustillos,R., Aguilar,M.B. and Falcón,A. (2009) Identification, by molecular cloning, of a novel type of I(2)-superfamily conotoxin precursor and two novel I(2)-conotoxins from the worm-hunter snail Conus spurius from the Gulf of México Peptides 31:384-393

Internal links

Protein Precursor	Sr11B precursor (3896)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 11 December 2023