Con-ikot-ikot precursor (P03890) Protein Card

General Information
Name Con-ikot-ikot precursor
Organism Conus striatus (Striated cone)
Organism region Indo-Pacific
Organism diet piscivorous
Protein Type Precursor

Classification
Conopeptide class con-ikot-ikot
Gene superfamily
Pharmacological family

Sequence
MAMNMSMTLCMFVMVVVA
ATVIDSTQLQEPDLSRMRR
SGPA
DCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGS
FNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA
Sequence region
[1-18]signal sequence
[38-123]mature peptideCon-ikot-ikot

References
Walker,C.S., Jensen,S., Ellison,M., Matta,J.A., Lee,W.Y., Imperial,J.S., Duclos,N., Brockie,P.J., Madsen,D.M., Isaac,J.T., Olivera,B. and Maricq,A.V. (2009) A novel Conus snail polypeptide causes excitotoxicity by blocking desensitization of AMPA receptors. Curr. Biol. 19:900-908

Internal links
Nucleic acids
Structure

External links
UniProtKB/Swiss-Prot P0CB20
Ncbi P0CB20

Tools