Mi15b (P03888) Protein Card

General Information

Name	Mi15b (named by ConoServer)
Alternative name(s)	Mi035
Organism	Conus miles
Organism region	Indo-Pacific
Organism diet	vermivorous
Protein Type	Wild type
Protein precursor	Mi15b precursor (3869) Mi15b precursor (6713)

Classification

Conopeptide class	conotoxin
Gene superfamily	O2 superfamily
Cysteine framework	XV
Pharmacological family

Sequence

QCTGAGFECEETPECCPNLTCKCSGSPLCTRYRCKT
Sequence evidence	nucleic acid level
Average Mass	3912.40
Monoisotopic Mass	3909.55
Isoelectric Point	7.77
Extinction Coefficient [280nm]	1490.00

References

Internal links

Protein Precursor	Mi15b precursor (3869) Mi15b precursor (6713)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 2 October 2023