Mr12.8 (P03882) Protein Card

General Information

Name	Mr12.8
Organism	Conus marmoreus
Organism region	Indo-Pacific
Organism diet	molluscivorous
Protein Type	Wild type
Protein precursor	Mr12.8 precursor (3858)

Classification

Conopeptide class	conotoxin
Gene superfamily	I2 superfamily
Cysteine framework	XII
Pharmacological family

Sequence

SCDSEFSSEFCEQPEERICSCSTHVCCHLSSSKGDQCMTWN RCLSAQTGN
Sequence evidence	nucleic acid level
Average Mass	5545.00
Monoisotopic Mass	5541.14
Isoelectric Point	4.89
Extinction Coefficient [280nm]	5500.00

References

Liu,Z., Yu,Z., Liu,N., Zhao,C., Hu,J. and Dai,Q. (2010) cDNA cloning of conotoxins with framework XII from several Conus species. Acta Biochim. Biophys. Sin. (Shanghai) 42:656-661

Internal links

Protein Precursor	Mr12.8 precursor (3858)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Thursday 28 September 2023