Ca11.3 (P03798) Protein Card

General Information
Name Ca11.3 (named by ConoServer)
Alternative name(s) Ca-25
Organism Conus caracteristicus (characteristic cone)
Organism region Indo-Pacific
Organism diet vermivorous
Protein Type Wild type
Protein precursor Ca11.3 precursor (3797)

Classification
Conopeptide class conotoxin
Gene superfamily I3 superfamily
Cysteine framework XI
Pharmacological family

Sequence
ASICYGTGGRCTKDKHCCGWLCCGGPSVGCVVSVAPC
Sequence evidence nucleic acid level
Average Mass 3671.25
Monoisotopic Mass 3668.50
Isoelectric Point 11.12
Extinction Coefficient [280nm] 6990.00

References
Yuan,D.D., Liu,L., Shao,X.X., Peng,C., Chi,C.W. and Guo,Z.Y. (2009) New conotoxins define the novel I3-superfamily. Peptides 30:861-865
Yao, G., Peng, C., Zhu, Y., Fan, C., Jiang, H., Chen, J., Cao, Y. and Shi, Q. (2019) High-Throughput Identification and Analysis of Novel Conotoxins from Three Vermivorous Cone Snails by Transcriptome Sequencing Marine drugs 17:193

Internal links
Protein Precursor Ca11.3 precursor (3797)
Nucleic acids
Structure

External links

Tools