Ac8.1 (P03394) Protein Card

General Information

Name	Ac8.1
Organism	Conus achatinus
Organism region	Indo-Pacific
Organism diet	piscivorous
Protein Type	Wild type
Protein precursor	Ac8.1 precursor (2822)
Notes	The sequence predicted by Liu et al. presents a final lysine, which should be cleaved by CPE.

Classification

Conopeptide class	conotoxin
Gene superfamily	S superfamily
Cysteine framework	VIII
Pharmacological family

Sequence

QCTLVNNCDRNGERACNGDCSCEGQICKCGYRVSPGKSGCA CTCRNA
Sequence evidence	nucleic acid level
Average Mass	4939.46
Monoisotopic Mass	4935.94
Isoelectric Point	10.31
Extinction Coefficient [280nm]	1490.00

References

Liu,L., Wu,X., Yuan,D., Chi,C. and Wang,C. (2008) Identification of a novel S-superfamily conotoxin from vermivorous Conus caracteristicus. Toxicon 51:1331-1337

Internal links

Protein Precursor	Ac8.1 precursor (2822)
Nucleic acids
Structure

External links

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 2 October 2023