Pn6.7 (P03111) Protein Card

General Information
Name Pn6.7
Organism Conus pennaceus
Organism region Indo-Pacific
Organism diet molluscivorous
Protein Type Wild type
Protein precursor Pn6.7 precursor (3112)

Classification
Conopeptide class conotoxin
Gene superfamily O1 superfamily
Cysteine framework VI/VII
Pharmacological family

Sequence
GCLEVDYFCGIPFVNNGLCCSGNCVFVCTPQ
Sequence evidence nucleic acid level
Average Mass 3296.77
Monoisotopic Mass 3294.34
Isoelectric Point 3.17
Extinction Coefficient [280nm] 1490.00

References

Internal links
Protein Precursor Pn6.7 precursor (3112)
Nucleic acids
Structure

External links

Tools