Bt11.4 (P02804) Protein Card

General Information

Name	Bt11.4
Organism	Conus betulinus
Organism region	Indo-Pacific
Organism diet	vermivorous
Protein Type	Wild type
Notes	The superfamily assignment is not supported by any available data but the cDNA extraction method is based on the conservation of 5' and 3' UTR.

Classification

Conopeptide class	conotoxin
Gene superfamily	I1 superfamily
Cysteine framework	XI
Pharmacological family

Sequence

MCLSLGQRCGRHSNCCGYLCCFYDKCVVTAIGCGHY
Sequence evidence	nucleic acid level
Average Mass	3957.60
Monoisotopic Mass	3954.59
Isoelectric Point	9.64
Extinction Coefficient [280nm]	4470.00

References

Buczek,O., Jimenez,E.C., Yoshikami,D., Imperial,J.S., Watkins,M., Morrison,A. and Olivera,B.M. (2008) I(1)-superfamily conotoxins and prediction of single D-amino acid occurrence. Toxicon 51:218-229

Internal links

Nucleic acids
Structure

External links

UniProtKB/Swiss-Prot	P0C609
Ncbi	P0C609

Tools

Please cite:
Kaas Q, Yu R, Jin AH, Dutertre S and Craik DJ. ConoServer: updated content, knowledge, and discovery tools in the conopeptide database. Nucleic Acids Research (2012) 40(Database issue):D325-30
Kaas Q, Westermann JC, Halai R, Wang CK and Craik DJ. ConoServer, a database for conopeptide sequences and structures. Bioinformatics (2008) 24(3):445-6

ConoServer is managed at the Institute of Molecular Bioscience IMB, Brisbane, Australia.

The database and computational tools found on this website may be used for academic research only, provided that it is referred to ConoServer, the database of conotoxins (http://www.conoserver.org) and the above reference is cited. For any other use please contact David Craik (d.craik@imb.uq.edu.au).

Contacts:
David Craik
Quentin Kaas

Last updated: Monday 11 December 2023